FCGR2A monoclonal antibody (M06), clone 3E8 View larger

FCGR2A monoclonal antibody (M06), clone 3E8

H00002212-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FCGR2A monoclonal antibody (M06), clone 3E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FCGR2A monoclonal antibody (M06), clone 3E8

Brand: Abnova
Reference: H00002212-M06
Product name: FCGR2A monoclonal antibody (M06), clone 3E8
Product description: Mouse monoclonal antibody raised against a partial recombinant FCGR2A.
Clone: 3E8
Isotype: IgG2a Kappa
Gene id: 2212
Gene name: FCGR2A
Gene alias: CD32|CD32A|CDw32|FCG2|FCGR2|FCGR2A1|FcGR|IGFR2|MGC23887|MGC30032
Gene description: Fc fragment of IgG, low affinity IIa, receptor (CD32)
Genbank accession: BC020823
Immunogen: FCGR2A (AAH20823, 46 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPL
Protein accession: AAH20823
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002212-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002212-M06-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged FCGR2A is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FCGR2A monoclonal antibody (M06), clone 3E8 now

Add to cart