FASN monoclonal antibody (M07), clone 3A2 View larger

FASN monoclonal antibody (M07), clone 3A2

H00002194-M07_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FASN monoclonal antibody (M07), clone 3A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about FASN monoclonal antibody (M07), clone 3A2

Brand: Abnova
Reference: H00002194-M07
Product name: FASN monoclonal antibody (M07), clone 3A2
Product description: Mouse monoclonal antibody raised against a partial recombinant FASN.
Clone: 3A2
Isotype: IgG2a Kappa
Gene id: 2194
Gene name: FASN
Gene alias: FAS|MGC14367|MGC15706|OA-519|SDR27X1
Gene description: fatty acid synthase
Genbank accession: NM_004104
Immunogen: FASN (NP_004095, 2378 a.a. ~ 2477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVI
Protein accession: NP_004095
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002194-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged FASN is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy FASN monoclonal antibody (M07), clone 3A2 now

Add to cart