Brand: | Abnova |
Reference: | H00002193-A01 |
Product name: | FARSLA polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant FARSLA. |
Gene id: | 2193 |
Gene name: | FARSA |
Gene alias: | CML33|FARSL|FARSLA|FRSA|PheHA |
Gene description: | phenylalanyl-tRNA synthetase, alpha subunit |
Genbank accession: | NM_004461 |
Immunogen: | FARSLA (NP_004452, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | KVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGS |
Protein accession: | NP_004452 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | FARSLA polyclonal antibody (A01), Lot # 060102JC01 Western Blot analysis of FARSLA expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |