Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FANCF monoclonal antibody (M03), clone 3C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
More info about FANCF monoclonal antibody (M03), clone 3C4
| Brand: | Abnova |
| Reference: | H00002188-M03 |
| Product name: | FANCF monoclonal antibody (M03), clone 3C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FANCF. |
| Clone: | 3C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2188 |
| Gene name: | FANCF |
| Gene alias: | FAF|MGC126856 |
| Gene description: | Fanconi anemia, complementation group F |
| Genbank accession: | NM_022725 |
| Immunogen: | FANCF (NP_073562.1, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDV |
| Protein accession: | NP_073562.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FANCF is 3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |