PTK2B monoclonal antibody (M03), clone X1 View larger

PTK2B monoclonal antibody (M03), clone X1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTK2B monoclonal antibody (M03), clone X1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PTK2B monoclonal antibody (M03), clone X1

Brand: Abnova
Reference: H00002185-M03
Product name: PTK2B monoclonal antibody (M03), clone X1
Product description: Mouse monoclonal antibody raised against a partial recombinant PTK2B.
Clone: X1
Isotype: IgG2a Kappa
Gene id: 2185
Gene name: PTK2B
Gene alias: CADTK|CAKB|FADK2|FAK2|FRNK|PKB|PTK|PYK2|RAFTK
Gene description: PTK2B protein tyrosine kinase 2 beta
Genbank accession: BC036651
Immunogen: PTK2B (AAH36651, 682 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA
Protein accession: AAH36651
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002185-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002185-M03-1-9-1.jpg
Application image note: PTK2B monoclonal antibody (M03), clone X1 Western Blot analysis of PTK2B expression in K-562.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTK2B monoclonal antibody (M03), clone X1 now

Add to cart