FAH monoclonal antibody (M01), clone 3G2 View larger

FAH monoclonal antibody (M01), clone 3G2

H00002184-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAH monoclonal antibody (M01), clone 3G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about FAH monoclonal antibody (M01), clone 3G2

Brand: Abnova
Reference: H00002184-M01
Product name: FAH monoclonal antibody (M01), clone 3G2
Product description: Mouse monoclonal antibody raised against a partial recombinant FAH.
Clone: 3G2
Isotype: IgG2a Kappa
Gene id: 2184
Gene name: FAH
Gene alias: -
Gene description: fumarylacetoacetate hydrolase (fumarylacetoacetase)
Genbank accession: BC002527
Immunogen: FAH (AAH02527.1, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSF
Protein accession: AAH02527.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002184-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged FAH is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy FAH monoclonal antibody (M01), clone 3G2 now

Add to cart