Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACSL3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ACSL3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002181-A01 |
| Product name: | ACSL3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ACSL3. |
| Gene id: | 2181 |
| Gene name: | ACSL3 |
| Gene alias: | ACS3|FACL3|PRO2194 |
| Gene description: | acyl-CoA synthetase long-chain family member 3 |
| Genbank accession: | NM_004457 |
| Immunogen: | ACSL3 (NP_004448, 203 a.a. ~ 288 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTS |
| Protein accession: | NP_004448 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ACSL3 polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of ACSL3 expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Increased Long Chain acyl-Coa Synthetase Activity and Fatty Acid Import Is Linked to Membrane Synthesis for Development of Picornavirus Replication Organelles.Nchoutmboube JA, Viktorova EG, Scott AJ, Ford LA, Pei Z, Watkins PA, Ernst RK, Belov GA. PLoS Pathog. 2013 Jun;9(6): e1003401. doi: 10.1371/ journal.ppat.1003401. |