Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002176-M01 |
Product name: | FANCC monoclonal antibody (M01), clone 6E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FANCC. |
Clone: | 6E7 |
Isotype: | IgG2b Kappa |
Gene id: | 2176 |
Gene name: | FANCC |
Gene alias: | FA3|FAC|FACC|FLJ14675 |
Gene description: | Fanconi anemia, complementation group C |
Genbank accession: | NM_000136 |
Immunogen: | FANCC (NP_000127, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINK |
Protein accession: | NP_000127 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FANCC expression in transfected 293T cell line by FANCC monoclonal antibody (M01), clone 6E7. Lane 1: FANCC transfected lysate(63.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |