Brand: | Abnova |
Reference: | H00002173-P01 |
Product name: | FABP7 (Human) Recombinant Protein (P01) |
Product description: | Human FABP7 full-length ORF ( AAH12299, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 2173 |
Gene name: | FABP7 |
Gene alias: | B-FABP|BLBP|DKFZp547J2313|FABPB|MRG |
Gene description: | fatty acid binding protein 7, brain |
Genbank accession: | BC012299 |
Immunogen sequence/protein sequence: | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
Protein accession: | AAH12299 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![qc_test-H00002173-P01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002173-P01-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | FABP7 and HMGCS2 Are Novel Protein Markers for Apocrine Differentiation Categorizing Apocrine Carcinoma of the Breast.Gromov P, Espinoza JA, Talman ML, Honma N, Kroman N, Wielenga VT, Moreira JM, Gromova I PLoS One. 2014 Nov 12;9(11):e112024. doi: 10.1371/journal.pone.0112024. eCollection 2014. |