Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr,IP |
Brand: | Abnova |
Reference: | H00002173-D02 |
Product name: | FABP7 MaxPab rabbit polyclonal antibody (D02) |
Product description: | Rabbit polyclonal antibody raised against a full-length human FABP7 protein. |
Gene id: | 2173 |
Gene name: | FABP7 |
Gene alias: | B-FABP|BLBP|DKFZp547J2313|FABPB|MRG |
Gene description: | fatty acid binding protein 7, brain |
Genbank accession: | BC012299.1 |
Immunogen: | FABP7 (AAH12299.1, 1 a.a. ~ 132 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
Protein accession: | AAH12299.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FABP7 expression in transfected 293T cell line (H00002173-T01) by FABP7 MaxPab polyclonal antibody. Lane 1: FABP7 transfected lysate(14.63 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |