FABP7 purified MaxPab rabbit polyclonal antibody (D01P) View larger

FABP7 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FABP7 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about FABP7 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002173-D01P
Product name: FABP7 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human FABP7 protein.
Gene id: 2173
Gene name: FABP7
Gene alias: B-FABP|BLBP|DKFZp547J2313|FABPB|MRG
Gene description: fatty acid binding protein 7, brain
Genbank accession: NM_001446
Immunogen: FABP7 (NP_001437.1, 1 a.a. ~ 132 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Protein accession: NP_001437.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002173-D01P-13-15-1.jpg
Application image note: Western Blot analysis of FABP7 expression in transfected 293T cell line (H00002173-T02) by FABP7 MaxPab polyclonal antibody.

Lane 1: FABP7 transfected lysate(14.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FABP7 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart