Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00002172-B01P |
Product name: | FABP6 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human FABP6 protein. |
Gene id: | 2172 |
Gene name: | FABP6 |
Gene alias: | I-15P|I-BABP|I-BALB|I-BAP|ILBP|ILBP3|ILLBP |
Gene description: | fatty acid binding protein 6, ileal |
Genbank accession: | BC022489 |
Immunogen: | FABP6 (AAH22489, 1 a.a. ~ 128 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
Protein accession: | AAH22489 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FABP6 expression in transfected 293T cell line (H00002172-T01) by FABP6 MaxPab polyclonal antibody. Lane 1: FABP6 transfected lysate(14.19 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |