Brand: | Abnova |
Reference: | H00002168-M04 |
Product name: | FABP1 monoclonal antibody (M04), clone 5E7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FABP1. |
Clone: | 5E7 |
Isotype: | IgG2b Kappa |
Gene id: | 2168 |
Gene name: | FABP1 |
Gene alias: | FABPL|L-FABP |
Gene description: | fatty acid binding protein 1, liver |
Genbank accession: | BC032801 |
Immunogen: | FABP1 (AAH32801, 1 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
Protein accession: | AAH32801 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.71 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FABP1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |