Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of F8 monoclonal antibody (M03), clone 1E8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,PLA-Ce |
More info about F8 monoclonal antibody (M03), clone 1E8
| Brand: | Abnova |
| Reference: | H00002157-M03 |
| Product name: | F8 monoclonal antibody (M03), clone 1E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant F8. |
| Clone: | 1E8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2157 |
| Gene name: | F8 |
| Gene alias: | AHF|DXS1253E|F8B|F8C|FVIII|HEMA |
| Gene description: | coagulation factor VIII, procoagulant component |
| Genbank accession: | NM_000132 |
| Immunogen: | F8 (NP_000123, 213 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITF |
| Protein accession: | NP_000123 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged F8 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,PLA-Ce |
| Shipping condition: | Dry Ice |