Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EVI2A purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr,Flow Cyt |
More info about EVI2A purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00002123-B01P |
| Product name: | EVI2A purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human EVI2A protein. |
| Gene id: | 2123 |
| Gene name: | EVI2A |
| Gene alias: | EVDA|EVI2 |
| Gene description: | ecotropic viral integration site 2A |
| Genbank accession: | BC035572 |
| Immunogen: | EVI2A (AAH35572, 25 a.a. ~ 236 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG |
| Protein accession: | AAH35572 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of EVI2A expression in transfected 293T cell line (H00002123-T01) by EVI2A MaxPab polyclonal antibody. Lane 1: EVI2A transfected lysate(26.07 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr,Flow Cyt |
| Shipping condition: | Dry Ice |