EVC polyclonal antibody (A01) View larger

EVC polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EVC polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about EVC polyclonal antibody (A01)

Brand: Abnova
Reference: H00002121-A01
Product name: EVC polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant EVC.
Gene id: 2121
Gene name: EVC
Gene alias: DWF-1|EVC1|EVCL|MGC105107
Gene description: Ellis van Creveld syndrome
Genbank accession: NM_014556
Immunogen: EVC (NP_055371, 493 a.a. ~ 602 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VLERQRLMQCDLEEEENVRATEAVVALCQELYFSTVDTFQKFVDALFLQTLPGMTGLPPEECDYLRQEVQENAAWQLGKSNRFRRQQWKLFQELLEQDQQVWMEECALSS
Protein accession: NP_055371
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002121-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EVC polyclonal antibody (A01) now

Add to cart