Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002118-M01 |
Product name: | ETV4 monoclonal antibody (M01), clone 3G9-1B9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ETV4. |
Clone: | 3G9-1B9 |
Isotype: | IgG2a kappa |
Gene id: | 2118 |
Gene name: | ETV4 |
Gene alias: | E1A-F|E1AF|PEA3|PEAS3 |
Gene description: | ets variant 4 |
Genbank accession: | BC007242 |
Immunogen: | ETV4 (AAH07242, 1 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY |
Protein accession: | AAH07242 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (48.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ETV4 expression in transfected 293T cell line by ETV4 monoclonal antibody (M01), clone 3G9-1B9. Lane 1: ETV4 transfected lysate(54 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | A fluorescence in situ hybridization screen for E26 transformation-specific aberrations: identification of DDX5-ETV4 fusion protein in prostate cancer.Han B, Mehra R, Dhanasekaran SM, Yu J, Menon A, Lonigro RJ, Wang X, Gong Y, Wang L, Shankar S, Laxman B, Shah RB, Varambally S, Palanisamy N, Tomlins SA, Kumar-Sinha C, Chinnaiyan AM. Cancer Res. 2008 Sep 15;68(18):7629-37. |