ESRRG MaxPab mouse polyclonal antibody (B01) View larger

ESRRG MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ESRRG MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ESRRG MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00002104-B01
Product name: ESRRG MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ESRRG protein.
Gene id: 2104
Gene name: ESRRG
Gene alias: DKFZp781L1617|ERR3|FLJ16023|KIAA0832|NR3B3
Gene description: estrogen-related receptor gamma
Genbank accession: NM_206594.1
Immunogen: ESRRG (NP_996317.1, 1 a.a. ~ 435 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Protein accession: NP_996317.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002104-B01-13-15-1.jpg
Application image note: Western Blot analysis of ESRRG expression in transfected 293T cell line (H00002104-T01) by ESRRG MaxPab polyclonal antibody.

Lane 1: ESRRG transfected lysate(47.85 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ESRRG MaxPab mouse polyclonal antibody (B01) now

Add to cart