Brand: | Abnova |
Reference: | H00002100-P01 |
Product name: | ESR2 (Human) Recombinant Protein (P01) |
Product description: | Human ESR2 full-length ORF ( AAH24181, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 2100 |
Gene name: | ESR2 |
Gene alias: | ER-BETA|ESR-BETA|ESRB|ESTRB|Erb|NR3A2 |
Gene description: | estrogen receptor 2 (ER beta) |
Genbank accession: | BC024181 |
Immunogen sequence/protein sequence: | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPRCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA |
Protein accession: | AAH24181 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![qc_test-H00002100-P01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002100-P01-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A Fragment of Adhesion Molecule L1 Binds to Nuclear Receptors to Regulate Synaptic Plasticity and Motor Coordination.Kraus K, Kleene R, Henis M, Braren I, Kataria H, Sharaf A, Loers G, Schachner M, Lutz D. Mol Neurobiol. 2018 Jan 30. [Epub ahead of print] |