ERCC2 (Human) Recombinant Protein (P01) View larger

ERCC2 (Human) Recombinant Protein (P01)

H00002068-P01_2ug

New product

279,00 € tax excl.

2 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERCC2 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ERCC2 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00002068-P01
Product name: ERCC2 (Human) Recombinant Protein (P01)
Product description: Human ERCC2 full-length ORF ( AAH08346, 1 a.a. - 405 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 2068
Gene name: ERCC2
Gene alias: COFS2|EM9|MGC102762|MGC126218|MGC126219|TTD|XPD
Gene description: excision repair cross-complementing rodent repair deficiency, complementation group 2
Genbank accession: BC008346
Immunogen sequence/protein sequence: MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQHCGSSRNQKRSHP
Protein accession: AAH08346
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00002068-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Cadmium inhibits non-homologous end-joining and over-activates the MRE11-dependent repair pathway.Viau M, Gastaldo J, Bencokova Z, Joubert A, Foray N.
Mutat Res. 2008 Jun 30;654(1):13-21. Epub 2008 May 2.

Reviews

Buy ERCC2 (Human) Recombinant Protein (P01) now

Add to cart