ERBB3 (Human) Recombinant Protein (P01) View larger

ERBB3 (Human) Recombinant Protein (P01)

New product

527,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERBB3 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ERBB3 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00002065-P01
Product name: ERBB3 (Human) Recombinant Protein (P01)
Product description: Human ERBB3 full-length ORF ( AAH02706, 21 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 2065
Gene name: ERBB3
Gene alias: ErbB-3|HER3|LCCS2|MDA-BF-1|MGC88033|c-erbB-3|c-erbB3|erbB3-S|p180-ErbB3|p45-sErbB3|p85-sErbB3
Gene description: v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
Genbank accession: BC002706
Immunogen sequence/protein sequence: EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF
Protein accession: AAH02706
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00002065-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ERBB3 (Human) Recombinant Protein (P01) now

Add to cart