Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EPHX1 monoclonal antibody (M02), clone 2B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about EPHX1 monoclonal antibody (M02), clone 2B1
| Brand: | Abnova |
| Reference: | H00002052-M02 |
| Product name: | EPHX1 monoclonal antibody (M02), clone 2B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHX1. |
| Clone: | 2B1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2052 |
| Gene name: | EPHX1 |
| Gene alias: | EPHX|EPOX|MEH |
| Gene description: | epoxide hydrolase 1, microsomal (xenobiotic) |
| Genbank accession: | BC008291 |
| Immunogen: | EPHX1 (AAH08291, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVP |
| Protein accession: | AAH08291 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |