Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EPHB3 monoclonal antibody (M10), clone 3F12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr,IP |
More info about EPHB3 monoclonal antibody (M10), clone 3F12
| Brand: | Abnova |
| Reference: | H00002049-M10 |
| Product name: | EPHB3 monoclonal antibody (M10), clone 3F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHB3. |
| Clone: | 3F12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2049 |
| Gene name: | EPHB3 |
| Gene alias: | ETK2|HEK2|TYRO6 |
| Gene description: | EPH receptor B3 |
| Genbank accession: | NM_004443 |
| Immunogen: | EPHB3 (NP_004434, 899 a.a. ~ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ |
| Protein accession: | NP_004434 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | EPHB3 monoclonal antibody (M10), clone 3F12 Western Blot analysis of EPHB3 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | YES oncogenic activity is specified by its SH4 domain and regulates RAS/MAPK signaling in colon carcinoma cells.Dubois F, Leroy C, Simon V, Benistant C, Roche S. Am J Cancer Res 2015;5(6):1972-1987. |