EPHB3 monoclonal antibody (M04A), clone 2G8 View larger

EPHB3 monoclonal antibody (M04A), clone 2G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EPHB3 monoclonal antibody (M04A), clone 2G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about EPHB3 monoclonal antibody (M04A), clone 2G8

Brand: Abnova
Reference: H00002049-M04A
Product name: EPHB3 monoclonal antibody (M04A), clone 2G8
Product description: Mouse monoclonal antibody raised against a partial recombinant EPHB3.
Clone: 2G8
Isotype: IgG2a Kappa
Gene id: 2049
Gene name: EPHB3
Gene alias: ETK2|HEK2|TYRO6
Gene description: EPH receptor B3
Genbank accession: NM_004443
Immunogen: EPHB3 (NP_004434, 899 a.a. ~ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ
Protein accession: NP_004434
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002049-M04A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002049-M04A-1-4-1.jpg
Application image note: EPHB3 monoclonal antibody (M04A), clone 2G8 Western Blot analysis of EPHB3 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EPHB3 monoclonal antibody (M04A), clone 2G8 now

Add to cart