Brand: | Abnova |
Reference: | H00002049-M02 |
Product name: | EPHB3 monoclonal antibody (M02), clone 1E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHB3. |
Clone: | 1E12 |
Isotype: | IgG1 Kappa |
Gene id: | 2049 |
Gene name: | EPHB3 |
Gene alias: | ETK2|HEK2|TYRO6 |
Gene description: | EPH receptor B3 |
Genbank accession: | NM_004443 |
Immunogen: | EPHB3 (NP_004434, 899 a.a. ~ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ |
Protein accession: | NP_004434 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002049-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002049-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00002049-M02-3-5-1-L.jpg](http://www.abnova.com/application_image/H00002049-M02-3-5-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to EPHB3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |