Brand: | Abnova |
Reference: | H00002042-M02 |
Product name: | EPHA3 monoclonal antibody (M02), clone 3E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHA3. |
Clone: | 3E9 |
Isotype: | IgG2b Kappa |
Gene id: | 2042 |
Gene name: | EPHA3 |
Gene alias: | ETK|ETK1|HEK|HEK4|TYRO4 |
Gene description: | EPH receptor A3 |
Genbank accession: | BC063282 |
Immunogen: | EPHA3 (AAH63282, 202 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPP |
Protein accession: | AAH63282 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002042-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002042-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (39.38 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00002042-M02-1-1-1.jpg](http://www.abnova.com/application_image/H00002042-M02-1-1-1.jpg) |
Application image note: | EPHA3 monoclonal antibody (M02), clone 3E9 Western Blot analysis of EPHA3 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |