Brand: | Abnova |
Reference: | H00002029-M02 |
Product name: | ENSA monoclonal antibody (M02), clone 1H7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ENSA. |
Clone: | 1H7 |
Isotype: | IgG2b Kappa |
Gene id: | 2029 |
Gene name: | ENSA |
Gene alias: | MGC4319|MGC78563|MGC8394 |
Gene description: | endosulfine alpha |
Genbank accession: | BC000436 |
Immunogen: | ENSA (AAH00436, 1 a.a. ~ 121 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE |
Protein accession: | AAH00436 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.05 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ENSA monoclonal antibody (M02), clone 1H7 Western Blot analysis of ENSA expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |