Brand: | Abnova |
Reference: | H00002018-M01 |
Product name: | EMX2 monoclonal antibody (M01), clone 3D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EMX2. |
Clone: | 3D5 |
Isotype: | IgG2a Kappa |
Gene id: | 2018 |
Gene name: | EMX2 |
Gene alias: | - |
Gene description: | empty spiracles homeobox 2 |
Genbank accession: | NM_004098 |
Immunogen: | EMX2 (NP_004089, 103 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV |
Protein accession: | NP_004089 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |