EMX2 monoclonal antibody (M01), clone 3D5 View larger

EMX2 monoclonal antibody (M01), clone 3D5

H00002018-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EMX2 monoclonal antibody (M01), clone 3D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about EMX2 monoclonal antibody (M01), clone 3D5

Brand: Abnova
Reference: H00002018-M01
Product name: EMX2 monoclonal antibody (M01), clone 3D5
Product description: Mouse monoclonal antibody raised against a partial recombinant EMX2.
Clone: 3D5
Isotype: IgG2a Kappa
Gene id: 2018
Gene name: EMX2
Gene alias: -
Gene description: empty spiracles homeobox 2
Genbank accession: NM_004098
Immunogen: EMX2 (NP_004089, 103 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV
Protein accession: NP_004089
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy EMX2 monoclonal antibody (M01), clone 3D5 now

Add to cart