Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EMP1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about EMP1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002012-A01 |
| Product name: | EMP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant EMP1. |
| Gene id: | 2012 |
| Gene name: | EMP1 |
| Gene alias: | CL-20|EMP-1|TMP |
| Gene description: | epithelial membrane protein 1 |
| Genbank accession: | BC047300 |
| Immunogen: | EMP1 (AAH47300, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK |
| Protein accession: | AAH47300 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.38 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Up-regulation of epithelial membrane protein-1 in the temporal neocortex of patients with intractable epilepsy.Li YQ, Xue T, Wang L, Xu ZC, Xi ZQ, Yuan J, Wang XF, Chen YM, Zhang M, Yao L. Neurochem Res. 2009 Sep;34(9):1594-602. Epub 2009 Mar 14. |