ELK4 purified MaxPab rabbit polyclonal antibody (D01P) View larger

ELK4 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELK4 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about ELK4 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002005-D01P
Product name: ELK4 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ELK4 protein.
Gene id: 2005
Gene name: ELK4
Gene alias: SAP1
Gene description: ELK4, ETS-domain protein (SRF accessory protein 1)
Genbank accession: NM_021795.2
Immunogen: ELK4 (NP_068567.1, 1 a.a. ~ 405 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM
Protein accession: NP_068567.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002005-D01P-13-15-1.jpg
Application image note: Western Blot analysis of ELK4 expression in transfected 293T cell line (H00002005-T03) by ELK4 MaxPab polyclonal antibody.

Lane 1: ELK4 transfected lysate(44.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ELK4 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart