ELA2 monoclonal antibody (M07A), clone 1A11 View larger

ELA2 monoclonal antibody (M07A), clone 1A11

H00001991-M07A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELA2 monoclonal antibody (M07A), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ELA2 monoclonal antibody (M07A), clone 1A11

Brand: Abnova
Reference: H00001991-M07A
Product name: ELA2 monoclonal antibody (M07A), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant ELA2.
Clone: 1A11
Isotype: IgG2a Kappa
Gene id: 1991
Gene name: ELA2
Gene alias: GE|HLE|HNE|NE|PMN-E
Gene description: elastase 2, neutrophil
Genbank accession: NM_001972
Immunogen: ELA2 (NP_001963, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Protein accession: NP_001963
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ELA2 monoclonal antibody (M07A), clone 1A11 now

Add to cart