Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ELA2 monoclonal antibody (M06J), clone 3B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about ELA2 monoclonal antibody (M06J), clone 3B1
| Brand: | Abnova |
| Reference: | H00001991-M06J |
| Product name: | ELA2 monoclonal antibody (M06J), clone 3B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ELA2. |
| Clone: | 3B1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1991 |
| Gene name: | ELA2 |
| Gene alias: | GE|HLE|HNE|NE|PMN-E |
| Gene description: | elastase 2, neutrophil |
| Genbank accession: | NM_001972 |
| Immunogen: | ELA2 (NP_001963, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH |
| Protein accession: | NP_001963 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |