EIF2S3 monoclonal antibody (M03), clone 1H3 View larger

EIF2S3 monoclonal antibody (M03), clone 1H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EIF2S3 monoclonal antibody (M03), clone 1H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about EIF2S3 monoclonal antibody (M03), clone 1H3

Brand: Abnova
Reference: H00001968-M03
Product name: EIF2S3 monoclonal antibody (M03), clone 1H3
Product description: Mouse monoclonal antibody raised against a partial recombinant EIF2S3.
Clone: 1H3
Isotype: IgG2a Kappa
Gene id: 1968
Gene name: EIF2S3
Gene alias: EIF2|EIF2G|EIF2gamma|eIF-2gA
Gene description: eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
Genbank accession: NM_001415
Immunogen: EIF2S3 (NP_001406, 383 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Protein accession: NP_001406
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001968-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001968-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged EIF2S3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EIF2S3 monoclonal antibody (M03), clone 1H3 now

Add to cart