EIF2B1 purified MaxPab mouse polyclonal antibody (B01P) View larger

EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001967-B01P
Product name: EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human EIF2B1 protein.
Gene id: 1967
Gene name: EIF2B1
Gene alias: EIF-2B|EIF-2Balpha|EIF2B|EIF2BA|MGC117409|MGC125868|MGC125869
Gene description: eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa
Genbank accession: NM_001414.2
Immunogen: EIF2B1 (NP_001405.1, 1 a.a. ~ 305 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
Protein accession: NP_001405.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001967-B01P-13-15-1.jpg
Application image note: Western Blot analysis of EIF2B1 expression in transfected 293T cell line (H00001967-T01) by EIF2B1 MaxPab polyclonal antibody.

Lane 1: EIF2B1 transfected lysate(33.55 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EIF2B1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart