Brand: | Abnova |
Reference: | H00001958-M08 |
Product name: | EGR1 monoclonal antibody (M08), clone 1F5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant EGR1. |
Clone: | 1F5 |
Isotype: | IgG2a Kappa |
Gene id: | 1958 |
Gene name: | EGR1 |
Gene alias: | AT225|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225 |
Gene description: | early growth response 1 |
Genbank accession: | NM_001964 |
Immunogen: | EGR1 (NP_001955, 211 a.a. ~ 320 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSR* |
Protein accession: | NP_001955 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | EGR1 monoclonal antibody (M08), clone 1F5 Western Blot analysis of EGR1 expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |