EGR1 monoclonal antibody (M05), clone 6A10 View larger

EGR1 monoclonal antibody (M05), clone 6A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EGR1 monoclonal antibody (M05), clone 6A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about EGR1 monoclonal antibody (M05), clone 6A10

Brand: Abnova
Reference: H00001958-M05
Product name: EGR1 monoclonal antibody (M05), clone 6A10
Product description: Mouse monoclonal antibody raised against a partial recombinant EGR1.
Clone: 6A10
Isotype: IgG2b Kappa
Gene id: 1958
Gene name: EGR1
Gene alias: AT225|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225
Gene description: early growth response 1
Genbank accession: NM_001964
Immunogen: EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Protein accession: NP_001955
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001958-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001958-M05-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged EGR1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EGR1 monoclonal antibody (M05), clone 6A10 now

Add to cart