Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EGR1 monoclonal antibody (M03), clone 6E8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about EGR1 monoclonal antibody (M03), clone 6E8
| Brand: | Abnova |
| Reference: | H00001958-M03 |
| Product name: | EGR1 monoclonal antibody (M03), clone 6E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EGR1. |
| Clone: | 6E8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1958 |
| Gene name: | EGR1 |
| Gene alias: | AT225|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225 |
| Gene description: | early growth response 1 |
| Genbank accession: | NM_001964 |
| Immunogen: | EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC |
| Protein accession: | NP_001955 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Induction of hypertrophy in vitro by mechanical loading in adult rabbit myocardium.Bupha-Intr T, Holmes JW, Janssen PM. Am J Physiol Heart Circ Physiol. 2007 Dec;293(6):H3759-67. Epub 2007 Oct 12. |