Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EGR1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about EGR1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001958-A01 |
| Product name: | EGR1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EGR1. |
| Gene id: | 1958 |
| Gene name: | EGR1 |
| Gene alias: | AT225|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225 |
| Gene description: | early growth response 1 |
| Genbank accession: | NM_001964 |
| Immunogen: | EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC |
| Protein accession: | NP_001955 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | EGR1 polyclonal antibody (A01), Lot # TTB0060123QCS1 Western Blot analysis of EGR1 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Progesterone-dependent deoxyribonucleic acid looping between RUSH/SMARCA3 and Egr-1 mediates repression by c-Rel.Hewetson A, Chilton BS. Mol Endocrinol. 2008 Apr;22(4):813-22. Epub 2008 Jan 3. |