Brand: | Abnova |
Reference: | H00001950-M01C |
Product name: | EGF monoclonal antibody (M01C), clone 2F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EGF. |
Clone: | 2F1 |
Isotype: | IgG2b Kappa |
Gene id: | 1950 |
Gene name: | EGF |
Gene alias: | HOMG4|URG |
Gene description: | epidermal growth factor (beta-urogastrone) |
Genbank accession: | NM_001963 |
Immunogen: | EGF (NP_001954, 926 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWKLRHA |
Protein accession: | NP_001954 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |