EGF monoclonal antibody (M01C), clone 2F1 View larger

EGF monoclonal antibody (M01C), clone 2F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EGF monoclonal antibody (M01C), clone 2F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about EGF monoclonal antibody (M01C), clone 2F1

Brand: Abnova
Reference: H00001950-M01C
Product name: EGF monoclonal antibody (M01C), clone 2F1
Product description: Mouse monoclonal antibody raised against a partial recombinant EGF.
Clone: 2F1
Isotype: IgG2b Kappa
Gene id: 1950
Gene name: EGF
Gene alias: HOMG4|URG
Gene description: epidermal growth factor (beta-urogastrone)
Genbank accession: NM_001963
Immunogen: EGF (NP_001954, 926 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWKLRHA
Protein accession: NP_001954
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001950-M01C-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EGF monoclonal antibody (M01C), clone 2F1 now

Add to cart