Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EFNA5 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about EFNA5 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001946-A01 |
| Product name: | EFNA5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EFNA5. |
| Gene id: | 1946 |
| Gene name: | EFNA5 |
| Gene alias: | AF1|EFL5|EPLG7|GLC1M|LERK7|RAGS |
| Gene description: | ephrin-A5 |
| Genbank accession: | NM_001962 |
| Immunogen: | EFNA5 (NP_001953, 114 a.a. ~ 203 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
| Protein accession: | NP_001953 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EFNA5 polyclonal antibody (A01), Lot # 051128JC01 Western Blot analysis of EFNA5 expression in U-2 OS ( Cat # L022V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | EphrinA1 Is Released in Three Forms from Cancer Cells by Matrix Metalloproteases.Beauchamp A, Lively MO, Mintz A, Gibo D, Wykosky J, Debinski W. Mol Cell Biol. 2012 Aug;32(16):3253-64. Epub 2012 Jun 11. |