EFNA3 monoclonal antibody (M02), clone 1C12 View larger

EFNA3 monoclonal antibody (M02), clone 1C12

H00001944-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EFNA3 monoclonal antibody (M02), clone 1C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about EFNA3 monoclonal antibody (M02), clone 1C12

Brand: Abnova
Reference: H00001944-M02
Product name: EFNA3 monoclonal antibody (M02), clone 1C12
Product description: Mouse monoclonal antibody raised against a full length recombinant EFNA3.
Clone: 1C12
Isotype: IgG1 Kappa
Gene id: 1944
Gene name: EFNA3
Gene alias: EFL2|EPLG3|Ehk1-L|LERK3
Gene description: ephrin-A3
Genbank accession: BC017722
Immunogen: EFNA3 (AAH17722, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Protein accession: AAH17722
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001944-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged EFNA3 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy EFNA3 monoclonal antibody (M02), clone 1C12 now

Add to cart