Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EEF1G MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about EEF1G MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00001937-B01 |
| Product name: | EEF1G MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human EEF1G protein. |
| Gene id: | 1937 |
| Gene name: | EEF1G |
| Gene alias: | EF1G|GIG35 |
| Gene description: | eukaryotic translation elongation factor 1 gamma |
| Genbank accession: | BC015813 |
| Immunogen: | EEF1G (AAH15813, 1 a.a. ~ 437 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK |
| Protein accession: | AAH15813 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of EEF1G expression in transfected 293T cell line (H00001937-T01) by EEF1G MaxPab polyclonal antibody. Lane 1: EEF1G transfected lysate(48.18 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Unbalanced expression of the translation complex eEF1 subunits in human cardioesophageal carcinoma.Veremieva M, Khoruzhenko A, Zaicev S, Negrutskii B, El'skaya A. Eur J Clin Invest. 2011 Mar;41(3):269-76. doi: 10.1111/j.1365-2362.2010.02404.x. Epub 2010 Oct 21. |