EEF1G polyclonal antibody (A01) View larger

EEF1G polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EEF1G polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about EEF1G polyclonal antibody (A01)

Brand: Abnova
Reference: H00001937-A01
Product name: EEF1G polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant EEF1G.
Gene id: 1937
Gene name: EEF1G
Gene alias: EF1G|GIG35
Gene description: eukaryotic translation elongation factor 1 gamma
Genbank accession: BC015813
Immunogen: EEF1G (AAH15813.1, 1 a.a. ~ 437 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Protein accession: AAH15813.1
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001937-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (74.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001937-A01-1-4-1.jpg
Application image note: EEF1G polyclonal antibody (A01), Lot # 061025JCS1 Western Blot analysis of EEF1G expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EEF1G polyclonal antibody (A01) now

Add to cart