H00001936-M04_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001936-M04 |
Product name: | EEF1D monoclonal antibody (M04), clone 4B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EEF1D. |
Clone: | 4B12 |
Isotype: | IgG2a Kappa |
Gene id: | 1936 |
Gene name: | EEF1D |
Gene alias: | EF-1D|EF1D|FLJ20897|FP1047 |
Gene description: | eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) |
Genbank accession: | NM_032378 |
Immunogen: | EEF1D (NP_115754, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRS |
Protein accession: | NP_115754 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged EEF1D is approximately 1ng/ml as a capture antibody. |
Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |