Brand: | Abnova |
Reference: | H00001936-A01 |
Product name: | EEF1D polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant EEF1D. |
Gene id: | 1936 |
Gene name: | EEF1D |
Gene alias: | EF-1D|EF1D|FLJ20897|FP1047 |
Gene description: | eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) |
Genbank accession: | NM_032378 |
Immunogen: | EEF1D (NP_115754, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRS |
Protein accession: | NP_115754 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |