EEF1B2 monoclonal antibody (M15), clone 3D12 View larger

EEF1B2 monoclonal antibody (M15), clone 3D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EEF1B2 monoclonal antibody (M15), clone 3D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about EEF1B2 monoclonal antibody (M15), clone 3D12

Brand: Abnova
Reference: H00001933-M15
Product name: EEF1B2 monoclonal antibody (M15), clone 3D12
Product description: Mouse monoclonal antibody raised against a full-length recombinant EEF1B2.
Clone: 3D12
Isotype: IgG1 Kappa
Gene id: 1933
Gene name: EEF1B2
Gene alias: EEF1B|EEF1B1|EF1B
Gene description: eukaryotic translation elongation factor 1 beta 2
Genbank accession: BC000211
Immunogen: EEF1B2 (AAH00211, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI
Protein accession: AAH00211
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001933-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.49 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EEF1B2 monoclonal antibody (M15), clone 3D12 now

Add to cart