EEF1B2 monoclonal antibody (M13), clone 4G8 View larger

EEF1B2 monoclonal antibody (M13), clone 4G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EEF1B2 monoclonal antibody (M13), clone 4G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about EEF1B2 monoclonal antibody (M13), clone 4G8

Brand: Abnova
Reference: H00001933-M13
Product name: EEF1B2 monoclonal antibody (M13), clone 4G8
Product description: Mouse monoclonal antibody raised against a full-length recombinant EEF1B2.
Clone: 4G8
Isotype: IgG1 Kappa
Gene id: 1933
Gene name: EEF1B2
Gene alias: EEF1B|EEF1B1|EF1B
Gene description: eukaryotic translation elongation factor 1 beta 2
Genbank accession: BC000211
Immunogen: EEF1B2 (AAH00211, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI
Protein accession: AAH00211
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001933-M13-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.49 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00001933-M13-1-12-1.jpg
Application image note: EEF1B2 monoclonal antibody (M13), clone 4G8. Western Blot analysis of EEF1B2 expression in HepG2.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EEF1B2 monoclonal antibody (M13), clone 4G8 now

Add to cart