Brand: | Abnova |
Reference: | H00001933-M10 |
Product name: | EEF1B2 monoclonal antibody (M10), clone 3A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EEF1B2. |
Clone: | 3A5 |
Isotype: | IgG2a Kappa |
Gene id: | 1933 |
Gene name: | EEF1B2 |
Gene alias: | EEF1B|EEF1B1|EF1B |
Gene description: | eukaryotic translation elongation factor 1 beta 2 |
Genbank accession: | NM_001959.3 |
Immunogen: | EEF1B2 (NP_001950.1, 29 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSG |
Protein accession: | NP_001950.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | EEF1B2 monoclonal antibody (M10), clone 3A5. Western Blot analysis of EEF1B2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Independent overexpression of the subunits of translation elongation factor complex eEF1H in human lung cancer.Veremieva M, Kapustian L, Khoruzhenko A, Zakharychev V, Negrutskii B BMC Cancer. 2014 Dec 3;14(1):913. |