Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EEF1A2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,ELISA,WB-Re |
More info about EEF1A2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001917-A01 |
| Product name: | EEF1A2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EEF1A2. |
| Gene id: | 1917 |
| Gene name: | EEF1A2 |
| Gene alias: | EEF1AL|EF-1-alpha-2|EF1A|FLJ41696|HS1|STN|STNL |
| Gene description: | eukaryotic translation elongation factor 1 alpha 2 |
| Genbank accession: | NM_001958 |
| Immunogen: | EEF1A2 (NP_001949, 364 a.a. ~ 462 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAG |
| Protein accession: | NP_001949 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb Western Blot analysis of EEF1A2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Degradation of newly synthesized polypeptides by ribosome-associated RACK1/JNK/eEF1A2 complex.Gandin V, Gutierrez GJ, Brill LM, Varsano T, Feng Y, Aza-Blanc P, Au Q, McLaughlan S, Ferreira TA, Alain T, Sonenberg N, Topisirovic I, Ronai ZA Mol Cell Biol. 2013 Apr 22. |