Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EEF1A1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about EEF1A1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001915-A01 |
| Product name: | EEF1A1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EEF1A1. |
| Gene id: | 1915 |
| Gene name: | EEF1A1 |
| Gene alias: | CCS-3|CCS3|EEF-1|EEF1A|EF-Tu|EF1A|FLJ25721|GRAF-1EF|HNGC:16303|LENG7|MGC102687|MGC131894|MGC16224|PTI1|eEF1A-1 |
| Gene description: | eukaryotic translation elongation factor 1 alpha 1 |
| Genbank accession: | BC009875 |
| Immunogen: | EEF1A1 (AAH09875, 156 a.a. ~ 255 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYK |
| Protein accession: | AAH09875 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EEF1A1 polyclonal antibody (A01). Western Blot analysis of EEF1A1 expression in K-562. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | EF1A1-Actin interactions alter mRNA stability to determine differential osteopontin expression in HepG2 and Hep3B cells.Zhang J, Guo H, Mi Z, Gao C, Bhattacharya S, Li J, Kuo PC. Exp Cell Res. 2009 Jan 15;315(2):304-12. Epub 2008 Nov 7. |